Lig235
Ligand information
- Ligand ID: Lig235
- Ligand Type : RNA
- Ligand Length : 17
- Ligand Sequence : GCCACCUACUUCGUGGC
Binding Experiments for this domain - 2
RRM domains tested for Binding - 1
| RRM Entryname | Sequence Range | RRM Sequence |
|---|---|---|
| Q8RWV8_RRM2 | 354 - 428 | LYIKNLAKDVVIDDFYYIFGSQFESSEVAKSSLGVRLMQEGRMRGQAFLTFPSVEVAHRALNLVNGFVFKGKPMI |