Heterogeneous nuclear ribonucleoproteins C1/C2

Protein information

  • Protein ID: P07910
  • Protein Name : Heterogeneous nuclear ribonucleoproteins C1/C2
  • Gene : HNRNPC
  • Organism : Homo sapiens
  • Status : reviewed
  • Function : Binds pre-mRNA and nucleates the assembly of 40S hnRNP particles (PubMed:8264621). Interacts with poly-U tracts in the 3'-UTR or 5'-UTR of mRNA and modulates the stability and the level of translation of bound mRNA molecules (PubMed:12509468 PubMed:16010978 PubMed:7567451 PubMed:8264621). Single HNRNPC tetramers bind 230-240 nucleotides. Trimers of HNRNPC tetramers bind 700 nucleotides (PubMed:8264621). May play a role in the early steps of spliceosome assembly and pre-mRNA splicing. N6-methyladenosine (m6A) has been shown to alter the local structure in mRNAs and long non-coding RNAs (lncRNAs) via a mechanism named 'm(6)A-switch' facilitating binding of HNRNPC leading to regulation of mRNA splicing (PubMed:25719671).

Protein Sequence

  • MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS

RRM domains in this Protein - 1 

RRM Entryname RRM Sequence range Pfam ID
P07910_RRM1 18 - 81 PF00076

Experiments retrieved for this Protein - 3 

Experiment ID Experiment Type PubMed ID
Exp_1WF2 NMR
Exp_2MXY NMR 25216038
Exp_2MZ1 NMR 25216038

Ligands tested for Binding - 2 

Ligand ID Ligand Type Ligand Sequence
Lig135 RNA UUUUC
Lig69 RNA AUUUUUC