Heterogeneous nuclear ribonucleoproteins C1/C2
-
Protein ID: P07910
- Protein Name : Heterogeneous nuclear ribonucleoproteins C1/C2
- Gene : HNRNPC
- Organism : Homo sapiens
- Status : reviewed
- Function : Binds pre-mRNA and nucleates the assembly of 40S hnRNP particles (PubMed:8264621). Interacts with poly-U tracts in the 3'-UTR or 5'-UTR of mRNA and modulates the stability and the level of translation of bound mRNA molecules (PubMed:12509468 PubMed:16010978 PubMed:7567451 PubMed:8264621). Single HNRNPC tetramers bind 230-240 nucleotides. Trimers of HNRNPC tetramers bind 700 nucleotides (PubMed:8264621). May play a role in the early steps of spliceosome assembly and pre-mRNA splicing. N6-methyladenosine (m6A) has been shown to alter the local structure in mRNAs and long non-coding RNAs (lncRNAs) via a mechanism named 'm(6)A-switch' facilitating binding of HNRNPC leading to regulation of mRNA splicing (PubMed:25719671).
- MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS
| RRM Entryname |
RRM Sequence range |
Pfam ID |
|
P07910_RRM1
|
18 - 81 |
PF00076 |
| Ligand ID |
Ligand Type |
Ligand Sequence |
|
Lig135 |
RNA |
UUUUC |
|
Lig69 |
RNA |
AUUUUUC |