Heterogeneous nuclear ribonucleoprotein A1
Protein information
- Status : reviewed
- Function : Involved in the packaging of pre-mRNA into hnRNP particles transport of poly(A) mRNA from the nucleus to the cytoplasm and modulation of splice site selection (PubMed:17371836). Plays a role in the splicing of pyruvate kinase PKM by binding repressively to sequences flanking PKM exon 9 inhibiting exon 9 inclusion and resulting in exon 10 inclusion and production of the PKM M2 isoform (PubMed:20010808). Binds to the IRES and thereby inhibits the translation of the apoptosis protease activating factor APAF1 (PubMed:31498791). May bind to specific miRNA hairpins (PubMed:28431233).
Protein Sequence
- MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF
RRM domains in this Protein - 2
RRM Entryname | RRM Sequence range | Pfam ID |
---|---|---|
P09651_RRM1 | 16 - 85 | PF00076 |
P09651_RRM2 | 107 - 176 | PF00076 |
RRM domain Linkers in this Protein - 1
Linker Name | Linker Sequence range |
---|---|
P09651_linker1 | 86 - 106 |
Experiments retrieved for this Protein - 19
Experiment ID | Experiment Type | PubMed ID |
---|---|---|
Exp_1HA1 | X-ray Diffraction | 9164463 |
Exp_1L3K | X-ray Diffraction | 11917013 |
Exp_1PGZ | X-ray Diffraction | 12904298 |
Exp_1PO6 | X-ray Diffraction | 12904298 |
Exp_1U1K | X-ray Diffraction | 15342234 |
Exp_1U1L | X-ray Diffraction | 15342234 |
Exp_1U1M | X-ray Diffraction | 15342234 |
Exp_1U1N | X-ray Diffraction | 15342234 |
Exp_1U1O | X-ray Diffraction | 15342234 |
Exp_1U1P | X-ray Diffraction | 15342234 |
Exp_1U1Q | X-ray Diffraction | 15342234 |
Exp_1U1R | X-ray Diffraction | 15342234 |
Exp_1UP1 | X-ray Diffraction | 9115444 |
Exp_2LYV | NMR | 23247503 |
Exp_2UP1 | X-ray Diffraction | 10323862 |
Exp_4YOE | X-ray Diffraction | 26003924 |
Exp_5MPG | NMR | 28650318 |
Exp_5MPL | NMR | 28650318 |
Exp_6DCL | X-ray Diffraction | 29946118 |