Protein sex-lethal
-
Protein ID: P19339
- Protein Name : Protein sex-lethal
- Gene : Sxl
- Organism : Drosophila melanogaster
- Status : reviewed
- Function : Sex determination switch protein which controls sexual development by sex-specific splicing. Regulates dosage compensation in females by suppressing hyperactivation of X-linked genes. Expression of the embryo-specific isoform is under the control of primary sex-determining signal which depends on the ratio of X chromosomes relative to autosomes (X:A ratio). Expression occurs in 2X:2A cells but not in X:2A cells. The X:A ratio seems to be signaled by the relative concentration of the X-linked transcription factors SIS-A and SIS-B. As a result the embryo-specific product is expressed early only in female embryos and specifies female-adult specific splicing; in the male where it is not expressed the default splicing gives rise to a truncated non-functional protein. The female-specific isoform specifies the splicing of its own transcript thereby initiating a positive autoregulatory feedback loop leading to female development pathway. The female-specific isoform controls the sex-specific splicing of transformer (TRA); acts as a translational repressor for male-specific lethal-2 (MSL-2) and prevents male-less (MLE) MSL-1 and MSL-3 proteins from associating with the female X chromosome.
- MYGNNNPGSNNNNGGYPPYGYNNKSSGGRGFGMSHSLPSGMSRYAFSPQDTEFSFPSSSSRRGYNDFPGCGGSGGNGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLGSGGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHFMSQMGVVPANVPPPPPQPPAHMAAAFNMMHRGRSIKSQQRFQNSHPYFDAKKFI
Ligand ID |
Ligand Type |
Ligand Sequence |
Lig209 |
RNA |
UUUUUUUGAGCACGUGAA |
Lig3 |
RNA |
GUUGUUUUUUUU |
Lig209 |
RNA |
UUUUUUUGAGCACGUGAA |
Lig3 |
RNA |
GUUGUUUUUUUU |