RNA-binding protein FUS

Protein information

  • Protein ID: P35637
  • Protein Name : RNA-binding protein FUS
  • Gene : FUS
  • Organism : Homo sapiens
  • Status : reviewed
  • Function : DNA/RNA-binding protein that plays a role in various cellular processes such as transcription regulation RNA splicing RNA transport DNA repair and damage response (PubMed:27731383). Binds to nascent pre-mRNAs and acts as a molecular mediator between RNA polymerase II and U1 small nuclear ribonucleoprotein thereby coupling transcription and splicing (PubMed:26124092). Binds also its own pre-mRNA and autoregulates its expression; this autoregulation mechanism is mediated by non-sense-mediated decay (PubMed:24204307). Plays a role in DNA repair mechanisms by promoting D-loop formation and homologous recombination during DNA double-strand break repair (PubMed:10567410). In neuronal cells plays crucial roles in dendritic spine formation and stability RNA transport mRNA stability and synaptic homeostasis (By similarity).

Protein Sequence

  • MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY

RRM domains in this Protein - 1 

RRM Entryname RRM Sequence range Pfam ID
P35637_RRM1 287 - 365 PF00076

Experiments retrieved for this Protein - 4 

Experiment ID Experiment Type PubMed ID
Exp_2LA6 NMR
Exp_2LCW NMR
Exp_6GBM NMR 30581145
Exp_6SNJ NMR 33311468

Ligands tested for Binding - 2 

Ligand ID Ligand Type Ligand Sequence
Lig181 RNA GGCAGAUUACAAUUCUAUUUGCC
Lig43 RNA GGGAUUUCCCCAAAUGUGGGAAACUCCC