Cytotoxic granule associated RNA binding protein TIA1
-
Protein ID: P52912
- Protein Name : Cytotoxic granule associated RNA binding protein TIA1
- Gene : Tia1
- Organism : Mus musculus
- Status : reviewed
- Function : RNA-binding protein involved in the regulation of alternative pre-RNA splicing and mRNA translation by binding to uridine-rich (U-rich) RNA sequences (PubMed:10938105 PubMed:16227602). Binds to U-rich sequences immediately downstream from a 5' splice sites in a uridine-rich small nuclear ribonucleoprotein (U snRNP)-dependent fashion thereby modulating alternative pre-RNA splicing (PubMed:10938105). Preferably binds to the U-rich IAS1 sequence in a U1 snRNP-dependent manner; this binding is optimal if a 5' splice site is adjacent to IAS1 (PubMed:10938105). Activates the use of heterologous 5' splice sites; the activation depends on the intron sequence downstream from the 5' splice site with a preference for a downstream U-rich sequence (PubMed:10938105). By interacting with SNRPC/U1-C promotes recruitment and binding of spliceosomal U1 snRNP to 5' splice sites followed by U-rich sequences thereby facilitating atypical 5' splice site recognition by U1 snRNP (By similarity). Activates splicing of alternative exons with weak 5' splice sites followed by a U-rich stretch on its own pre-mRNA and on TIAR mRNA (PubMed:11514562). Acts as a modulator of alternative splicing for the apoptotic FAS receptor thereby promoting apoptosis (By similarity). Binds to the 5' splice site region of FAS intron 5 to promote accumulation of transcripts that include exon 6 at the expense of transcripts in which exon 6 is skipped thereby leading to the transcription of a membrane-bound apoptotic FAS receptor which promotes apoptosis (By similarity). Binds to a conserved AU-rich cis element in COL2A1 intron 2 and modulates alternative splicing of COL2A1 exon 2 (By similarity). Also binds to the equivalent AT-rich element in COL2A1 genomic DNA and may thereby be involved in the regulation of transcription (By similarity). Involved in the repression of mRNA translation by binding to AU-rich elements (AREs) located in mRNA 3' untranslated regions (3' UTRs) including target ARE-bearing mRNAs encoding TNF and PTGS2 (PubMed:16227602 PubMed:10921895). Also participates in the cellular response to environmental stress by acting downstream of the stress-induced phosphorylation of EIF2S1/EIF2A to promote the recruitment of untranslated mRNAs to cytoplasmic stress granules (SGs) leading to stress-induced translational arrest (By similarity). Formation and recruitment to SGs is regulated by Zn(2+) (PubMed:29298433). Possesses nucleolytic activity against cytotoxic lymphocyte target cells (By similarity).
- MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVSQSSPNNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPPTYGQWGQWYGNAQQIGQYVPNGWQVPAYGVYGQPWSQQGFNQTQSSAPWMGPNYSVPPPQGQNGSMLPSQPAGYRVAGYETQ