Splicing regulator RBM11

Protein information

  • Protein ID: P57052
  • Protein Name : Splicing regulator RBM11
  • Gene : RBM11
  • Organism : Homo sapiens
  • Status : reviewed
  • Function : Tissue-specific splicing factor with potential implication in the regulation of alternative splicing during neuron and germ cell differentiation. Antagonizes SRSF1-mediated BCL-X splicing. May affect the choice of alternative 5' splice sites by binding to specific sequences in exons and antagonizing the SR protein SRSF1.

Protein Sequence

  • MFPAQEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTICKDREGKPKSFGFVCFKHPESVSYAIALLNGIRLYGRPINVQYRFGSSRSSEPANQSFESCVKINSHNYRNEEMLVGRSSFPMQYFPINNTSLPQEYFLFQKMQWHVYNPVLQLPYYEMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNRGNECSQKFRKSKKKKRY

RRM domains in this Protein - 1 

RRM Entryname RRM Sequence range Pfam ID
P57052_RRM1 12 - 81 PF00076

Experiments retrieved for this Protein - 1 

Experiment ID Experiment Type PubMed ID
Exp_2YWK X-ray Diffraction