Splicing regulator RBM11
-
Protein ID: P57052
- Protein Name : Splicing regulator RBM11
- Gene : RBM11
- Organism : Homo sapiens
- Status : reviewed
- Function : Tissue-specific splicing factor with potential implication in the regulation of alternative splicing during neuron and germ cell differentiation. Antagonizes SRSF1-mediated BCL-X splicing. May affect the choice of alternative 5' splice sites by binding to specific sequences in exons and antagonizing the SR protein SRSF1.
- MFPAQEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTICKDREGKPKSFGFVCFKHPESVSYAIALLNGIRLYGRPINVQYRFGSSRSSEPANQSFESCVKINSHNYRNEEMLVGRSSFPMQYFPINNTSLPQEYFLFQKMQWHVYNPVLQLPYYEMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNRGNECSQKFRKSKKKKRY
RRM Entryname |
RRM Sequence range |
Pfam ID |
P57052_RRM1
|
12 - 81 |
PF00076 |
Experiment ID |
Experiment Type |
PubMed ID |
Exp_2YWK |
X-ray Diffraction |
|