Cold-inducible RNA-binding protein
-
Protein ID: Q14011
- Protein Name : Cold-inducible RNA-binding protein
- Gene : CIRBP
- Organism : Homo sapiens
- Status : reviewed
- Function : Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor (By similarity). Promotes assembly of stress granules (SGs) when overexpressed.
- MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
RRM Entryname |
RRM Sequence range |
Pfam ID |
Q14011_RRM1
|
8 - 78 |
PF00076 |
Experiment ID |
Experiment Type |
PubMed ID |
Exp_1X5S |
NMR |
|
Exp_5TBX |
X-ray Diffraction |
28368279
|