Cold-inducible RNA-binding protein

Protein information

  • Protein ID: Q14011
  • Protein Name : Cold-inducible RNA-binding protein
  • Gene : CIRBP
  • Organism : Homo sapiens
  • Status : reviewed
  • Function : Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor (By similarity). Promotes assembly of stress granules (SGs) when overexpressed.

Protein Sequence

  • MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE

RRM domains in this Protein - 1 

RRM Entryname RRM Sequence range Pfam ID
Q14011_RRM1 8 - 78 PF00076

Experiments retrieved for this Protein - 2 

Experiment ID Experiment Type PubMed ID
Exp_1X5S NMR
Exp_5TBX X-ray Diffraction 28368279