Serine/arginine-rich splicing factor 7

Protein information

  • Protein ID: Q16629
  • Protein Name : Serine/arginine-rich splicing factor 7
  • Gene : SRSF7
  • Organism : Homo sapiens
  • Status : reviewed
  • Function : Required for pre-mRNA splicing. Can also modulate alternative splicing in vitro. Represses the splicing of MAPT/Tau exon 10. May function as export adapter involved in mRNA nuclear export such as of histone H2A. Binds mRNA which is thought to be transferred to the NXF1-NXT1 heterodimer for export (TAP/NXF1 pathway); enhances NXF1-NXT1 RNA-binding activity. RNA-binding is semi-sequence specific.

Protein Sequence

  • MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD

RRM domains in this Protein - 1 

RRM Entryname RRM Sequence range Pfam ID
Q16629_RRM1 13 - 78 PF00076

Experiments retrieved for this Protein - 1 

Experiment ID Experiment Type PubMed ID
Exp_2HVZ NMR 17036044