Serine/arginine-rich splicing factor 7
-
Protein ID: Q16629
- Protein Name : Serine/arginine-rich splicing factor 7
- Gene : SRSF7
- Organism : Homo sapiens
- Status : reviewed
- Function : Required for pre-mRNA splicing. Can also modulate alternative splicing in vitro. Represses the splicing of MAPT/Tau exon 10. May function as export adapter involved in mRNA nuclear export such as of histone H2A. Binds mRNA which is thought to be transferred to the NXF1-NXT1 heterodimer for export (TAP/NXF1 pathway); enhances NXF1-NXT1 RNA-binding activity. RNA-binding is semi-sequence specific.
- MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD
RRM Entryname |
RRM Sequence range |
Pfam ID |
Q16629_RRM1
|
13 - 78 |
PF00076 |
Experiment ID |
Experiment Type |
PubMed ID |
Exp_2HVZ |
NMR |
17036044
|