Serine/arginine-rich splicing factor 1

Protein information

  • Protein ID: Q6PDM2
  • Protein Name : Serine/arginine-rich splicing factor 1
  • Gene : Srsf1
  • Organism : Mus musculus
  • Status : reviewed
  • Function : Plays a role in preventing exon skipping ensuring the accuracy of splicing and regulating alternative splicing (PubMed:28785060). Interacts with other spliceosomal components via the RS domains to form a bridge between the 5'- and 3'-splice site binding components U1 snRNP and U2AF. Can stimulate binding of U1 snRNP to a 5'-splice site-containing pre-mRNA. Binds to purine-rich RNA sequences either the octamer 5'-RGAAGAAC-3' (r=A or G) or the decamers AGGACAGAGC/AGGACGAAGC. Binds preferentially to the 5'-CGAGGCG-3' motif in vitro. Three copies of the octamer constitute a powerful splicing enhancer in vitro the ASF/SF2 splicing enhancer (ASE) which can specifically activate ASE-dependent splicing (By similarity). Specifically regulates alternative splicing of cardiac isoforms of CAMK2D LDB3/CYPHER and TNNT2/CTNT during heart remodeling at the juvenile to adult transition. The inappropriate accumulation of a neonatal and neuronal isoform of CAMKD2 in the adult heart results in aberrant calcium handling and defective excitation-contraction coupling in cardiomyocytes. May function as export adapter involved in mRNA nuclear export through the TAP/NXF1 pathway (PubMed:15652482).

Protein Sequence

  • MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT

RRM domains in this Protein - 2 

RRM Entryname RRM Sequence range Pfam ID
Q6PDM2_RRM1 18 - 85 PF00076
Q6PDM2_RRM2 123 - 186 PF00076

RRM domain Linkers in this Protein - 1 

Linker Name Linker Sequence range
Q6PDM2_linker1 86 - 122

Experiments retrieved for this Protein - 1 

Experiment ID Experiment Type PubMed ID
Exp_1X4C NMR