Serine/arginine-rich splicing factor 1
-
Protein ID: Q6PDM2
- Protein Name : Serine/arginine-rich splicing factor 1
- Gene : Srsf1
- Organism : Mus musculus
- Status : reviewed
- Function : Plays a role in preventing exon skipping ensuring the accuracy of splicing and regulating alternative splicing (PubMed:28785060). Interacts with other spliceosomal components via the RS domains to form a bridge between the 5'- and 3'-splice site binding components U1 snRNP and U2AF. Can stimulate binding of U1 snRNP to a 5'-splice site-containing pre-mRNA. Binds to purine-rich RNA sequences either the octamer 5'-RGAAGAAC-3' (r=A or G) or the decamers AGGACAGAGC/AGGACGAAGC. Binds preferentially to the 5'-CGAGGCG-3' motif in vitro. Three copies of the octamer constitute a powerful splicing enhancer in vitro the ASF/SF2 splicing enhancer (ASE) which can specifically activate ASE-dependent splicing (By similarity). Specifically regulates alternative splicing of cardiac isoforms of CAMK2D LDB3/CYPHER and TNNT2/CTNT during heart remodeling at the juvenile to adult transition. The inappropriate accumulation of a neonatal and neuronal isoform of CAMKD2 in the adult heart results in aberrant calcium handling and defective excitation-contraction coupling in cardiomyocytes. May function as export adapter involved in mRNA nuclear export through the TAP/NXF1 pathway (PubMed:15652482).
- MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT
| Experiment ID |
Experiment Type |
PubMed ID |
|
Exp_1X4C |
NMR |
|