THO complex subunit 4
-
Protein ID: Q86V81
- Protein Name : THO complex subunit 4
- Gene : ALYREF
- Organism : Homo sapiens
- Status : reviewed
- Function : Export adapter involved in nuclear export of spliced and unspliced mRNA. Binds mRNA which is thought to be transferred to the NXF1-NXT1 heterodimer for export (TAP/NFX1 pathway) (PubMed:15833825 PubMed:15998806 PubMed:17190602 PubMed:11707413 PubMed:11675789 PubMed:11979277 PubMed:18364396 PubMed:22144908 PubMed:22893130 PubMed:23222130 PubMed:25662211). Component of the TREX complex which is thought to couple mRNA transcription processing and nuclear export and specifically associates with spliced mRNA and not with unspliced pre-mRNA (PubMed:15833825 PubMed:15998806 PubMed:17190602). TREX is recruited to spliced mRNAs by a transcription-independent mechanism binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm (PubMed:15833825 PubMed:15998806 PubMed:17190602). TREX recruitment occurs via an interaction between ALYREF/THOC4 and the cap-binding protein NCBP1 (PubMed:15833825 PubMed:15998806 PubMed:17190602). The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production; ALYREF/THOC4 mediates the recruitment of the TREX complex to the intronless viral mRNA (PubMed:18974867). Required for TREX complex assembly and for linking DDX39B to the cap-binding complex (CBC) (PubMed:15998806 PubMed:17984224). In conjunction with THOC5 functions in NXF1-NXT1 mediated nuclear export of HSP70 mRNA; both proteins enhance the RNA binding activity of NXF1 and are required for NXF1 localization to the nuclear rim (PubMed:19165146). Involved in the nuclear export of intronless mRNA; proposed to be recruited to intronless mRNA by ATP-bound DDX39B. Involved in transcription elongation and genome stability (PubMed:12438613 PubMed:17984224). Involved in mRNA export of C5-methylcytosine (m5C)-containing mRNAs: specifically recognizes and binds m5C mRNAs and mediates their nucleo-cytoplasmic shuttling (PubMed:28418038).
- MADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAYNARMDTS
RRM Entryname |
RRM Sequence range |
Pfam ID |
Q86V81_RRM1
|
108 - 177 |
PF00076 |
Experiment ID |
Experiment Type |
PubMed ID |
Exp_3ULH |
X-ray Diffraction |
|