CCR4-NOT transcription complex subunit 4

Protein information

  • Protein ID: Q8BT14
  • Protein Name : CCR4-NOT transcription complex subunit 4
  • Gene : Cnot4
  • Organism : Mus musculus
  • Status : reviewed
  • Function : Has E3 ubiquitin ligase activity promoting ubiquitination and degradation of target proteins. Involved in activation of the JAK/STAT pathway. Catalyzes ubiquitination of methylated RBM15. Plays a role in quality control of translation of mitochondrial outer membrane-localized mRNA. As part of the PINK1-regulated signaling upon mitochondria damage ubiquitinates ABCE1 and thereby recruits autophagy receptors to the mitochondrial outer membrane to initiate mitophagy.

Protein Sequence

  • MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTPSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNASSHTTTAKGPGSGFLHSAAPTNANSLNSTFSVLPQRFPQFQQHRAVYNSFGFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPIAGEEEVKVSTMPLSASSHSLQQGQQPTSLHTTVA

RRM domains in this Protein - 1 

RRM Entryname RRM Sequence range Pfam ID
Q8BT14_RRM1 111 - 187 PF00076

Experiments retrieved for this Protein - 1 

Experiment ID Experiment Type PubMed ID
Exp_2CPI NMR