CCR4-NOT transcription complex subunit 4
-
Protein ID: Q8BT14
- Protein Name : CCR4-NOT transcription complex subunit 4
- Gene : Cnot4
- Organism : Mus musculus
- Status : reviewed
- Function : Has E3 ubiquitin ligase activity promoting ubiquitination and degradation of target proteins. Involved in activation of the JAK/STAT pathway. Catalyzes ubiquitination of methylated RBM15. Plays a role in quality control of translation of mitochondrial outer membrane-localized mRNA. As part of the PINK1-regulated signaling upon mitochondria damage ubiquitinates ABCE1 and thereby recruits autophagy receptors to the mitochondrial outer membrane to initiate mitophagy.
- MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTPSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNASSHTTTAKGPGSGFLHSAAPTNANSLNSTFSVLPQRFPQFQQHRAVYNSFGFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPIAGEEEVKVSTMPLSASSHSLQQGQQPTSLHTTVA
| RRM Entryname |
RRM Sequence range |
Pfam ID |
|
Q8BT14_RRM1
|
111 - 187 |
PF00076 |
| Experiment ID |
Experiment Type |
PubMed ID |
|
Exp_2CPI |
NMR |
|