Nucleoporin NUP35
-
Protein ID: Q8R4R6
- Protein Name : Nucleoporin NUP35
- Gene : Nup35
- Organism : Mus musculus
- Status : reviewed
- Function : Functions as a component of the nuclear pore complex (NPC). NPC components collectively referred to as nucleoporins (NUPs) can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. May play a role in the association of MAD1 with the NPC (By similarity).
- MAAFAVDPQAPTLGSEPMMLGSPTSPKTGANAQFLPGFLMGDLPAPVTPQPRSISGPSVGVMEMRSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQANISLLQSPLVGATTPVPGQSMFSPANIGQPRKTTLSPAQLDPFYTQGDSLTSEDHLDDTWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVKPCIDKNVMENSDRGVLSSPSLAFTTPIRTLGTPTQSGSTPRVSTMRPLATAYKASTSDYQVISDRQTPKKDESLVSRAMEYMFGW
RRM Entryname |
RRM Sequence range |
Pfam ID |
Q8R4R6_RRM1
|
166 - 251 |
PF05172 |
Experiment ID |
Experiment Type |
PubMed ID |
Exp_1WWH |
X-ray Diffraction |
16962612
|