Nucleoporin NUP35

Protein information

  • Protein ID: Q8R4R6
  • Protein Name : Nucleoporin NUP35
  • Gene : Nup35
  • Organism : Mus musculus
  • Status : reviewed
  • Function : Functions as a component of the nuclear pore complex (NPC). NPC components collectively referred to as nucleoporins (NUPs) can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. May play a role in the association of MAD1 with the NPC (By similarity).

Protein Sequence

  • MAAFAVDPQAPTLGSEPMMLGSPTSPKTGANAQFLPGFLMGDLPAPVTPQPRSISGPSVGVMEMRSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQANISLLQSPLVGATTPVPGQSMFSPANIGQPRKTTLSPAQLDPFYTQGDSLTSEDHLDDTWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVKPCIDKNVMENSDRGVLSSPSLAFTTPIRTLGTPTQSGSTPRVSTMRPLATAYKASTSDYQVISDRQTPKKDESLVSRAMEYMFGW

RRM domains in this Protein - 1 

RRM Entryname RRM Sequence range Pfam ID
Q8R4R6_RRM1 166 - 251 PF05172

Experiments retrieved for this Protein - 1 

Experiment ID Experiment Type PubMed ID
Exp_1WWH X-ray Diffraction 16962612