Heterogeneous nuclear ribonucleoprotein A/B

Protein information

  • Protein ID: Q99729
  • Protein Name : Heterogeneous nuclear ribonucleoprotein A/B
  • Gene : HNRNPAB
  • Organism : Homo sapiens
  • Status : reviewed
  • Function : Binds single-stranded RNA. Has a high affinity for G-rich and U-rich regions of hnRNA. Also binds to APOB mRNA transcripts around the RNA editing site.

Protein Sequence

  • MSEAGEEQPMETTGATENGHEAVPEASRGRGWTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPESPTEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGGGGGGQSQSWNQGYGNYWNQGYGYQQGYGPGYGGYDYSPYGYYGYGPGYDYSQGSTNYGKSQRRGGHQNNYKPY

RRM domains in this Protein - 2 

RRM Entryname RRM Sequence range Pfam ID
Q99729_RRM1 71 - 140 PF00076
Q99729_RRM2 155 - 224 PF00076

RRM domain Linkers in this Protein - 1 

Linker Name Linker Sequence range
Q99729_linker1 141 - 154

Experiments retrieved for this Protein - 1 

Experiment ID Experiment Type PubMed ID
Exp_3S7R X-ray Diffraction