Serine/arginine-rich splicing factor 9

Protein information

  • Protein ID: Q9D0B0
  • Protein Name : Serine/arginine-rich splicing factor 9
  • Gene : Srsf9
  • Organism : Mus musculus
  • Status : reviewed
  • Function : Plays a role in constitutive splicing and can modulate the selection of alternative splice sites. Represses the splicing of MAPT/Tau exon 10 (By similarity).

Protein Sequence

  • MSSGWADERGGEGDGRIYVGNLPSDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGARNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGMGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY

RRM domains in this Protein - 2 

RRM Entryname RRM Sequence range Pfam ID
Q9D0B0_RRM1 17 - 84 PF00076
Q9D0B0_RRM2 114 - 177 PF00076

RRM domain Linkers in this Protein - 1 

Linker Name Linker Sequence range
Q9D0B0_linker1 85 - 113

Experiments retrieved for this Protein - 1 

Experiment ID Experiment Type PubMed ID
Exp_1WG4 NMR