tRNA selenocysteine 1-associated protein 1

Protein information

  • Protein ID: Q9NX07
  • Protein Name : tRNA selenocysteine 1-associated protein 1
  • Gene : TRNAU1AP
  • Organism : Homo sapiens
  • Status : reviewed
  • Function : Involved in the early steps of selenocysteine biosynthesis and tRNA(Sec) charging to the later steps resulting in the cotranslational incorporation of selenocysteine into selenoproteins. Stabilizes the SECISBP2 EEFSEC and tRNA(Sec) complex. May be involved in the methylation of tRNA(Sec). Enhances efficiency of selenoproteins synthesis (By similarity).

Protein Sequence

  • MAASLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFKLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQTGVSKGYGFVKFTDELEQKRALTECQGAVGLGSKPVRLSVAIPKASRVKPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTMQTYEEVGDDALEDPMPQLDVTEANKEFMEQSEELYDALMDCHWQPLDTVSSEIPAMM

RRM domains in this Protein - 2 

RRM Entryname RRM Sequence range Pfam ID
Q9NX07_RRM1 5 - 75 PF00076
Q9NX07_RRM2 98 - 169 PF00076

RRM domain Linkers in this Protein - 1 

Linker Name Linker Sequence range
Q9NX07_linker1 76 - 97

Experiments retrieved for this Protein - 2 

Experiment ID Experiment Type PubMed ID
Exp_2DHG NMR
Exp_2DIV NMR