RNA-binding protein 8A

Protein information

  • Protein ID: Q9V535
  • Protein Name : RNA-binding protein 8A
  • Gene : tsu
  • Organism : Drosophila melanogaster
  • Status : reviewed
  • Function : Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs (PubMed:14973490 PubMed:24967911). Involved in exon definition of genes containing long introns including the rolled/MAPK gene (PubMed:20946982 PubMed:20946983). The mago-tsu heterodimer interacts with the EJC key regulator Pym leading to EJC disassembly in the cytoplasm (PubMed:24967911). Has a role in oskar mRNA localization to the posterior pole of the developing oocyte (PubMed:11691839).

Protein Sequence

  • MADVLDIDNAEEFEVDEDGDQGIVRLKEKAKHRKGRGFGSDSNTREAIHSYERVRNEDDDELEPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKGPKRVKKSEKRRR

RRM domains in this Protein - 1 

RRM Entryname RRM Sequence range Pfam ID
Q9V535_RRM1 75 - 145 PF00076

Experiments retrieved for this Protein - 4 

Experiment ID Experiment Type PubMed ID
Exp_1HL6 X-ray Diffraction 12730685
Exp_1OO0 X-ray Diffraction 12704080
Exp_1RK8 X-ray Diffraction 14968132
Exp_2X1G X-ray Diffraction 20122403