RNA-binding protein 7

Protein information

  • Protein ID: Q9Y580
  • Protein Name : RNA-binding protein 7
  • Gene : RBM7
  • Organism : Homo sapiens
  • Status : reviewed
  • Function : RNA-binding subunit of the trimeric nuclear exosome targeting (NEXT) complex a complex that functions as an RNA exosome cofactor that directs a subset of non-coding short-lived RNAs for exosomal degradation (PubMed:25189701 PubMed:25578728 PubMed:25525152 PubMed:25852104 PubMed:27871484). NEXT is involved in surveillance and turnover of aberrant transcripts and non-coding RNAs (PubMed:25189701 PubMed:27871484 PubMed:25852104). Binds preferentially polyuridine sequences and associates with newly synthesized RNAs including pre-mRNAs and short-lived exosome substrates such as promoter upstream transcripts (PROMPTs) enhancer RNAs (eRNAs) and 3'-extended products from small nuclear RNAs (snRNAs) (PubMed:25189701 PubMed:25578728 PubMed:25525152 PubMed:25852104). Participates in several biological processes including DNA damage response (DDR) and stress response (PubMed:25525152 PubMed:30824372). During stress response activation of the p38MAPK-MK2 pathway decreases RBM7-RNA-binding and subsequently the RNA exosome degradation activities thereby modulating the turnover of non-coding transcriptome (PubMed:25525152). Participates in DNA damage response (DDR) through its interaction with MEPCE and LARP7 the core subunits of 7SK snRNP complex that release the positive transcription elongation factor b (P-TEFb) complex from the 7SK snRNP. In turn activation of P-TEFb complex induces the transcription of P-TEFb-dependent DDR genes to promote cell viability (PubMed:30824372).

Protein Sequence

  • MGAAAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKLYGRPIKIQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSRYERTMDNMTSSAQIIQRSFSSPENFQRQAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHSFNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYRGKRDDFFYEDRNHDDWSHDYDNRRDSSRDGKWRSSRH

RRM domains in this Protein - 1 

RRM Entryname RRM Sequence range Pfam ID
Q9Y580_RRM1 12 - 81 PF00076

Experiments retrieved for this Protein - 4 

Experiment ID Experiment Type PubMed ID
Exp_2M8H NMR
Exp_5IQQ X-ray Diffraction 27139832
Exp_5LXR X-ray Diffraction 27905398
Exp_5LXY X-ray Diffraction 27905398