Lig145
Ligand information
- Ligand ID: Lig145
- Ligand Type : RNA
- Ligand Length : 8
- Ligand Sequence : UGAAGGAC
Available Structures for this Ligand- 1
| Ligand Structurename | PDB ID | Chain ID |
|---|---|---|
| 2M8DA00 | 2M8D | A |
Binding Information from Structures
| Experiment ID | RRM Structure | RRM Entryename | Experiment Type | Ligand ID | Contacts |
|---|---|---|---|---|---|
| Exp_2M8D | 2M8DB01 | Q07955_RRM2 | NMR | Lig145 | Contacts |
RRM domains tested for Binding - 1
| RRM Entryname | Sequence Range | RRM Sequence |
|---|---|---|
| Q07955_RRM2 | 123 - 186 | VVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGE |