Lig157
Ligand information
- Ligand ID: Lig157
- Ligand Type : RNA
- Ligand Length : 5
- Ligand Sequence : ACACA
Available Structures for this Ligand- 2
Binding Information from Structures
| Experiment ID | RRM Structure | RRM Entryename | Experiment Type | Ligand ID | Contacts |
|---|---|---|---|---|---|
| Exp_2MQQ | 2MQQA01 | F1LQ48_RRM3 | NMR | Lig157 | Contacts |
RRM domains tested for Binding - 1
| RRM Entryname | Sequence Range | RRM Sequence |
|---|---|---|
| F1LQ48_RRM3 | 390 - 514 | PSRYGPQYGHPPPPPPPPDYGPHADSPVLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKMNVCVSKQPAIMPGQSYGLEDGSCSYKDFSES |