Lig201
Ligand information
- Ligand ID: Lig201
- Ligand Type : DNA
- Ligand Length : 4
- Ligand Sequence : TAGG
Available Structures for this Ligand- 2
Binding Information from Structures
| Experiment ID | RRM Structure | RRM Entryename | Experiment Type | Ligand ID | Contacts |
|---|---|---|---|---|---|
| Exp_1WTB | 1WTBA01 | Q14103_RRM2 | NMR | Lig201 | Contacts |
| Exp_1X0F | 1X0FA01 | Q14103_RRM2 | NMR | Lig201 | Contacts |
RRM domains tested for Binding - 1
| RRM Entryname | Sequence Range | RRM Sequence |
|---|---|---|
| Q14103_RRM2 | 184 - 255 | IFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIK |