Lig202
Ligand information
- Ligand ID: Lig202
- Ligand Type : RNA
- Ligand Length : 6
- Ligand Sequence : AGAGAU
Available Structures for this Ligand- 1
| Ligand Structurename | PDB ID | Chain ID |
|---|---|---|
| 2KH9B00 | 2KH9 | B |
Binding Information from Structures
| Experiment ID | RRM Structure | RRM Entryename | Experiment Type | Ligand ID | Contacts |
|---|---|---|---|---|---|
| Exp_2KH9 | 2KH9A01 | P49960_RRM2 | NMR | Lig202 | Contacts |
RRM domains tested for Binding - 1
| RRM Entryname | Sequence Range | RRM Sequence |
|---|---|---|
| P49960_RRM2 | 119 - 189 | LWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLV |