Lig279
Ligand information
- Ligand ID: Lig279
- Ligand Type : RNA
- Ligand Length : 20
- Ligand Sequence : UUUUUUUUUUUUUUUUUUUU
Binding Experiments for this domain - 6
| Experiment ID | RRM Entryname | Experiment Type | Ligand ID | Binds? | Binding Affinity |
|---|---|---|---|---|---|
| Exp_1 | Q389P7_RRM1 | Fluorescence polarization | Lig279 | Yes | 1.4 ± 0.03 μM |
| Exp_6 | Q389P7_RRM1 | Fluorescence polarization | Lig279 | No | |
| Exp_8 | Q389P7_RRM1 | Fluorescence polarization | Lig279 | No | |
| Exp_15 | Q389P7_RRM1 | Fluorescence polarization | Lig279 | Yes | 240 ± 37 nM |
| Exp_21 | Q389P7_RRM1 | Fluorescence polarization | Lig279 | No | |
| Exp_22 | Q389P7_RRM1 | Fluorescence polarization | Lig279 | No |
RRM domains tested for Binding - 1
| RRM Entryname | Sequence Range | RRM Sequence |
|---|---|---|
| Q389P7_RRM1 | 194 - 256 | VQVSGLSDETTWHTLKDHLRQAGEVTFCKVFSGGRAVVEFVTPEDAARAITELQASELEGATL |