Lig303
Ligand information
- Ligand ID: Lig303
- Ligand Type : RNA
- Ligand Length : 14
- Ligand Sequence : UUCAUUUAGUUUUU
Binding Experiments for this domain - 2
RRM domains tested for Binding - 2
| RRM Entryname | Sequence Range | RRM Sequence |
|---|---|---|
| Q61474_RRM1 | 22 - 91 | MFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTID |
| Q61474_RRM2 | 111 - 180 | IFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVE |