Lig345
Ligand information
- Ligand ID: Lig345
- Ligand Type : RNA
- Ligand Length : 6
- Ligand Sequence : CCCAGU
Binding Experiments for this domain - 1
| Experiment ID | RRM Entryname | Experiment Type | Ligand ID | Binds? | Binding Affinity |
|---|---|---|---|---|---|
| Exp_386 | Q01130_RRM1 | ITC | Lig345 | Yes | 0.47 ± 0.02 μM |
RRM domains tested for Binding - 1
| RRM Entryname | Sequence Range | RRM Sequence |
|---|---|---|
| Q01130_RRM1 | 16 - 86 | LKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELR |