Lig38
Ligand information
- Ligand ID: Lig38
- Ligand Type : DNA
- Ligand Length : 7
- Ligand Sequence : TCTTATT
Available Structures for this Ligand- 1
| Ligand Structurename | PDB ID | Chain ID |
|---|---|---|
| 6M75C00 | 6M75 | C |
Binding Information from Structures
| Experiment ID | RRM Structure | RRM Entryename | Experiment Type | Ligand ID | Contacts |
|---|---|---|---|---|---|
| Exp_6M75 | 6M75A01 | P29558_RRM1 | X-ray Diffraction | Lig38 | Contacts |
RRM domains tested for Binding - 1
| RRM Entryname | Sequence Range | RRM Sequence |
|---|---|---|
| P29558_RRM1 | 64 - 129 | LYIRGLPPHTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSALKASGVQ |