Lig59
Ligand information
- Ligand ID: Lig59
- Ligand Type : RNA
- Ligand Length : 12
- Ligand Sequence : GUUGUUUUGUUU
Available Structures for this Ligand- 4
Binding Information from Structures
| Experiment ID | RRM Structure | RRM Entryename | Experiment Type | Ligand ID | Contacts |
|---|---|---|---|---|---|
| Exp_3NMR | 3NMRA02 | Q92879_RRM2 | X-ray Diffraction | Lig59 | Contacts |
| Exp_3NNA | 3NNAA02 | Q92879_RRM2 | X-ray Diffraction | Lig59 | Contacts |
| Exp_3NNH | 3NNHA01 | Q92879_RRM1 | X-ray Diffraction | Lig59 | Contacts |
| Exp_3NNH | 3NNHB01 | Q92879_RRM1 | X-ray Diffraction | Lig59 | Contacts |
| Exp_3NNH | 3NNHC01 | Q92879_RRM1 | X-ray Diffraction | Lig59 | Contacts |
| Exp_3NNH | 3NNHD01 | Q92879_RRM1 | X-ray Diffraction | Lig59 | Contacts |
RRM domains tested for Binding - 2
| RRM Entryname | Sequence Range | RRM Sequence |
|---|---|---|
| Q92879_RRM1 | 18 - 88 | MFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGM |
| Q92879_RRM2 | 110 - 178 | LFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCS |