Lig70
Ligand information
- Ligand ID: Lig70
- Ligand Type : RNA
- Ligand Length : 31
- Ligand Sequence : GGCGCUGCAUGUGGCAGUCUGCCUUUCUUUU
Available Structures for this Ligand- 2
Binding Information from Structures
| Experiment ID | RRM Structure | RRM Entryename | Experiment Type | Ligand ID | Contacts |
|---|---|---|---|---|---|
| Exp_4WKR | 4WKRA01 | Q4G0J3_RRM1 | X-ray Diffraction | Lig70 | Contacts |
| Exp_4WKR | 4WKRB01 | Q4G0J3_RRM1 | X-ray Diffraction | Lig70 | Contacts |
RRM domains tested for Binding - 1
| RRM Entryname | Sequence Range | RRM Sequence |
|---|---|---|
| Q4G0J3_RRM1 | 127 - 190 | VYVELLPKNVNHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNPP |