Lig73
Ligand information
- Ligand ID: Lig73
- Ligand Type : RNA
- Ligand Length : 10
- Ligand Sequence : AAGGACUUGC
Available Structures for this Ligand- 1
| Ligand Structurename | PDB ID | Chain ID |
|---|---|---|
| 5WWGB00 | 5WWG | B |
Binding Information from Structures
| Experiment ID | RRM Structure | RRM Entryename | Experiment Type | Ligand ID | Contacts |
|---|---|---|---|---|---|
| Exp_5WWG | 5WWGA01 | P22626_RRM1 | X-ray Diffraction | Lig73 | Contacts |
RRM domains tested for Binding - 1
| RRM Entryname | Sequence Range | RRM Sequence |
|---|---|---|
| P22626_RRM1 | 23 - 92 | LFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVE |