Lig81
Ligand information
- Ligand ID: Lig81
- Ligand Type : RNA
- Ligand Length : 4
- Ligand Sequence : GUAA
Available Structures for this Ligand- 1
| Ligand Structurename | PDB ID | Chain ID |
|---|---|---|
| 5O1YB00 | 5O1Y | B |
Binding Information from Structures
| Experiment ID | RRM Structure | RRM Entryename | Experiment Type | Ligand ID | Contacts |
|---|---|---|---|---|---|
| Exp_5O1Y | 5O1YA01 | P53617_RRM1 | X-ray Diffraction | Lig81 | Contacts |
RRM domains tested for Binding - 1
| RRM Entryname | Sequence Range | RRM Sequence |
|---|---|---|
| P53617_RRM1 | 341 - 400 | LFIGGVPLNMKEWDLANVLKPFAEVQSVILNNSRKHAFVKVYSRHEAENVLQNFNKDGAL |