Serine/arginine-rich splicing factor 3

Protein information

  • Protein ID: P84103
  • Protein Name : Serine/arginine-rich splicing factor 3
  • Gene : SRSF3
  • Organism : Homo sapiens
  • Status : reviewed
  • Function : Splicing factor that specifically promotes exon-inclusion during alternative splicing (PubMed:26876937). Interaction with YTHDC1 a RNA-binding protein that recognizes and binds N6-methyladenosine (m6A)-containing RNAs promotes recruitment of SRSF3 to its mRNA-binding elements adjacent to m6A sites leading to exon-inclusion during alternative splicing (PubMed:26876937). Also functions as export adapter involved in mRNA nuclear export (PubMed:11336712 PubMed:18364396 PubMed:28984244). Binds mRNA which is thought to be transferred to the NXF1-NXT1 heterodimer for export (TAP/NXF1 pathway); enhances NXF1-NXT1 RNA-binding activity (PubMed:11336712 PubMed:18364396). Involved in nuclear export of m6A-containing mRNAs via interaction with YTHDC1: interaction with YTHDC1 facilitates m6A-containing mRNA-binding to both SRSF3 and NXF1 promoting mRNA nuclear export (PubMed:28984244). RNA-binding is semi-sequence specific (PubMed:17036044).

Protein Sequence

  • MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK

RRM domains in this Protein - 1 

RRM Entryname RRM Sequence range Pfam ID
P84103_RRM1 12 - 77 PF00076

Experiments retrieved for this Protein - 2 

Experiment ID Experiment Type PubMed ID
Exp_2I2Y NMR 17036044
Exp_2I38 NMR 17036044

Ligands tested for Binding - 1 

Ligand ID Ligand Type Ligand Sequence
Lig141 RNA CAUC