Serine/arginine-rich splicing factor 1
-
Protein ID: Q07955
- Protein Name : Serine/arginine-rich splicing factor 1
- Gene : SRSF1
- Organism : Homo sapiens
- Status : reviewed
- Function : Plays a role in preventing exon skipping ensuring the accuracy of splicing and regulating alternative splicing. Interacts with other spliceosomal components via the RS domains to form a bridge between the 5'- and 3'-splice site binding components U1 snRNP and U2AF. Can stimulate binding of U1 snRNP to a 5'-splice site-containing pre-mRNA. Binds to purine-rich RNA sequences either the octamer 5'-RGAAGAAC-3' (r=A or G) or the decamers AGGACAGAGC/AGGACGAAGC. Binds preferentially to the 5'-CGAGGCG-3' motif in vitro. Three copies of the octamer constitute a powerful splicing enhancer in vitro the ASF/SF2 splicing enhancer (ASE) which can specifically activate ASE-dependent splicing. Isoform ASF-2 and isoform ASF-3 act as splicing repressors. May function as export adapter involved in mRNA nuclear export through the TAP/NXF1 pathway.
- MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT
Ligand ID |
Ligand Type |
Ligand Sequence |
Lig120 |
RNA |
AACAAA |
Lig145 |
RNA |
UGAAGGAC |