Serine/arginine-rich splicing factor 1

Protein information

  • Protein ID: Q07955
  • Protein Name : Serine/arginine-rich splicing factor 1
  • Gene : SRSF1
  • Organism : Homo sapiens
  • Status : reviewed
  • Function : Plays a role in preventing exon skipping ensuring the accuracy of splicing and regulating alternative splicing. Interacts with other spliceosomal components via the RS domains to form a bridge between the 5'- and 3'-splice site binding components U1 snRNP and U2AF. Can stimulate binding of U1 snRNP to a 5'-splice site-containing pre-mRNA. Binds to purine-rich RNA sequences either the octamer 5'-RGAAGAAC-3' (r=A or G) or the decamers AGGACAGAGC/AGGACGAAGC. Binds preferentially to the 5'-CGAGGCG-3' motif in vitro. Three copies of the octamer constitute a powerful splicing enhancer in vitro the ASF/SF2 splicing enhancer (ASE) which can specifically activate ASE-dependent splicing. Isoform ASF-2 and isoform ASF-3 act as splicing repressors. May function as export adapter involved in mRNA nuclear export through the TAP/NXF1 pathway.

Protein Sequence

  • MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT

RRM domains in this Protein - 2 

RRM Entryname RRM Sequence range Pfam ID
Q07955_RRM1 18 - 85 PF00076
Q07955_RRM2 123 - 186 PF00076

RRM domain Linkers in this Protein - 1 

Linker Name Linker Sequence range
Q07955_linker1 86 - 122

Experiments retrieved for this Protein - 8 

Experiment ID Experiment Type PubMed ID
Exp_1X4A NMR
Exp_2M7S NMR
Exp_2M8D NMR 23836656
Exp_2O3D NMR 17668007
Exp_3BEG X-ray Diffraction 18342604
Exp_4C0O X-ray Diffraction 24449914
Exp_6HPJ NMR 33462199
Exp_7ABG EM 33243851

Ligands tested for Binding - 2 

Ligand ID Ligand Type Ligand Sequence
Lig120 RNA AACAAA
Lig145 RNA UGAAGGAC