Deleted in azoospermia-like
        
	    
    		
            
			
				
					
                        - 
                            Protein ID: Q64368
                            
                                
                            
                        
- Protein Name : Deleted in azoospermia-like
- Gene : Dazl
- Organism : Mus musculus
 
			 
            
                
					
						- Status : reviewed
- Function : RNA-binding protein which is essential for gametogenesis in both males and females. Plays a central role during spermatogenesis. Acts by binding to the 3'-UTR of mRNA specifically recognizing GUU triplets and thereby regulating the translation of key transcripts.
 
			 
             
    		
				
                
                
                    -  MSATTSEAPNSAVSREASTQSSSATTSQGYVLPEGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKGYGFVSFYNDVDVQKIVESQINFHGKKLKLGPAIRKQNLCTYHVQPRPLIFNPPPPPQFQSVWSSPNAETYMQPPTMMNPITQYVQAYPPYPSSPVQVITGYQLPVYNYQMPPQWPAGEQRSYVIPPAYTTVNYHCSEVDPGADILPNECSVHDAAPASGNGPQKKSVDRSIQTVVSCLFNPENRLRNSLVTQDDYFKDKRVHHFRRSRAVLKSDHLC
 
			 
                        
				
				
                    
                        
                            | RRM Entryname | RRM Sequence range | Pfam ID | 
                                | Q64368_RRM1 | 42 - 109 | PF00076 | 
                                                    
                    
                        
			 
            
            
                        
				
				
                    
                        
                            | Experiment ID | Experiment Type | PubMed ID | 
                                | Exp_2XS2 | X-ray Diffraction | 22021443 | 
                                                        
                                | Exp_2XS5 | X-ray Diffraction | 22021443 | 
                                                        
                                | Exp_2XS7 | X-ray Diffraction | 22021443 | 
                                                        
                                | Exp_2XSF | X-ray Diffraction | 22021443 | 
                                                    
                    
                        
			 
            
                          
				
				
                    
                        
                            | Ligand ID | Ligand Type | Ligand Sequence | 
                                | Lig159 | RNA | UUGUUU | 
                                                        
                                | Lig2 | RNA | UGUUC | 
                                                        
                                | Lig20 | RNA | UUGUUCUU |