CUGBP Elav-like family member 1

Protein information

  • Protein ID: Q92879
  • Protein Name : CUGBP Elav-like family member 1
  • Gene : CELF1
  • Organism : Homo sapiens
  • Status : reviewed
  • Function : RNA-binding protein implicated in the regulation of several post-transcriptional events. Involved in pre-mRNA alternative splicing mRNA translation and stability. Mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. Specifically activates exon 5 inclusion of cardiac isoforms of TNNT2 during heart remodeling at the juvenile to adult transition. Acts as both an activator and repressor of a pair of coregulated exons: promotes inclusion of the smooth muscle (SM) exon but exclusion of the non-muscle (NM) exon in actinin pre-mRNAs. Activates SM exon 5 inclusion by antagonizing the repressive effect of PTB. Promotes exclusion of exon 11 of the INSR pre-mRNA. Inhibits together with HNRNPH1 insulin receptor (IR) pre-mRNA exon 11 inclusion in myoblast. Increases translation and controls the choice of translation initiation codon of CEBPB mRNA. Increases mRNA translation of CEBPB in aging liver (By similarity). Increases translation of CDKN1A mRNA by antagonizing the repressive effect of CALR3. Mediates rapid cytoplasmic mRNA deadenylation. Recruits the deadenylase PARN to the poly(A) tail of EDEN-containing mRNAs to promote their deadenylation. Required for completion of spermatogenesis (By similarity). Binds to (CUG)n triplet repeats in the 3'-UTR of transcripts such as DMPK and to Bruno response elements (BREs). Binds to muscle-specific splicing enhancer (MSE) intronic sites flanking the alternative exon 5 of TNNT2 pre-mRNA. Binds to AU-rich sequences (AREs or EDEN-like) localized in the 3'-UTR of JUN and FOS mRNAs. Binds to the IR RNA. Binds to the 5'-region of CDKN1A and CEBPB mRNAs. Binds with the 5'-region of CEBPB mRNA in aging liver. May be a specific regulator of miRNA biogenesis. Binds to primary microRNA pri-MIR140 and with CELF2 negatively regulates the processing to mature miRNA (PubMed:28431233).

Protein Sequence

  • MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALYLQLLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY

RRM domains in this Protein - 3 

RRM Entryname RRM Sequence range Pfam ID
Q92879_RRM1 18 - 88 PF00076
Q92879_RRM2 110 - 178 PF00076
Q92879_RRM3 403 - 473 PF00076

RRM domain Linkers in this Protein - 2 

Linker Name Linker Sequence range
Q92879_linker1 89 - 109
Q92879_linker2 179 - 402

Experiments retrieved for this Protein - 8 

Experiment ID Experiment Type PubMed ID
Exp_2CPZ NMR
Exp_2DHS NMR
Exp_2RQ4 NMR 19553194
Exp_2RQC NMR 19553194
Exp_3NMR X-ray Diffraction 20947024
Exp_3NNA X-ray Diffraction 20947024
Exp_3NNC X-ray Diffraction 20947024
Exp_3NNH X-ray Diffraction 20947024

Ligands tested for Binding - 4 

Ligand ID Ligand Type Ligand Sequence
Lig59 RNA GUUGUUUUGUUU
Lig59 RNA GUUGUUUUGUUU
Lig94 RNA UGUGUGUUGUGUG
Lig169 RNA UGUGUG