Q9UKA9_RRM3
Protein information
- Protein ID: Q9UKA9
- Protein Name: Polypyrimidine tract-binding protein 2
- Organism: Homo sapiens
- Gene Name: PTBP2
Domain Sequence
- LHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQDHKMALLQMATVEEAIQALIDLHNYNLGENH
Available Structures for this domain - 9
| Experiment ID | RRM Structure | Experiment Type | Ligand ID | Contacts |
|---|---|---|---|---|
| Exp_2MJU | 2MJUA02 | NMR | No contacts | |
| Exp_4CQ1 | 4CQ1A02 | X-ray Diffraction | No contacts | |
| Exp_4CQ1 | 4CQ1B02 | X-ray Diffraction | No contacts | |
| Exp_4CQ1 | 4CQ1C02 | X-ray Diffraction | No contacts | |
| Exp_4CQ1 | 4CQ1D02 | X-ray Diffraction | No contacts | |
| Exp_4CQ1 | 4CQ1E02 | X-ray Diffraction | No contacts | |
| Exp_4CQ1 | 4CQ1F02 | X-ray Diffraction | No contacts | |
| Exp_4CQ1 | 4CQ1G02 | X-ray Diffraction | No contacts | |
| Exp_4CQ1 | 4CQ1H02 | X-ray Diffraction | No contacts |