Lig16
Ligand information
- Ligand ID: Lig16
- Ligand Type : RNA
- Ligand Length : 59
- Ligand Sequence : GUAUGUAUUUAUUUUAGAACUAGUUACUAACAUUUUUUUUUUAAAAAAUAAUUAUAUAG
Available Structures for this Ligand- 1
| Ligand Structurename | PDB ID | Chain ID |
|---|---|---|
| 6BK8i00 | 6BK8 | i |
Binding Information from Structures
| Experiment ID | RRM Structure | RRM Entryename | Experiment Type | Ligand ID | Contacts |
|---|---|---|---|---|---|
| Exp_6BK8 | 6BK8G01 | Q12046_RRM1 | EM | Lig16 | Contacts |
RRM domains tested for Binding - 1
| RRM Entryname | Sequence Range | RRM Sequence |
|---|---|---|
| Q12046_RRM1 | 149 - 206 | KHLKPAQIESRIRFVFSRLGDIDRIRYVESKNCGFVKFKYQANAEFAKEAMSNQTLLL |