Lig166
Ligand information
- Ligand ID: Lig166
- Ligand Type : RNA
- Ligand Length : 5
- Ligand Sequence : GUAGU
Available Structures for this Ligand- 2
Binding Information from Structures
| Experiment ID | RRM Structure | RRM Entryename | Experiment Type | Ligand ID | Contacts |
|---|---|---|---|---|---|
| Exp_2RS2 | 2RS2A01 | Q61474_RRM1 | NMR | Lig166 | Contacts |
| Exp_5X3Z | 5X3ZA01 | Q61474_RRM2 | NMR | Lig166 | Contacts |
RRM domains tested for Binding - 2
| RRM Entryname | Sequence Range | RRM Sequence |
|---|---|---|
| Q61474_RRM1 | 22 - 91 | MFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTID |
| Q61474_RRM2 | 111 - 180 | IFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVE |