Lig175
Ligand information
- Ligand ID: Lig175
- Ligand Type : RNA
- Ligand Length : 5
- Ligand Sequence : UGUAA
Available Structures for this Ligand- 2
Binding Information from Structures
| Experiment ID | RRM Structure | RRM Entryename | Experiment Type | Ligand ID | Contacts |
|---|---|---|---|---|---|
| Exp_3P6Y | 3P6YC01 | Q16630_RRM1 | X-ray Diffraction | Lig175 | Contacts |
| Exp_3P6Y | 3P6YD01 | Q16630_RRM1 | X-ray Diffraction | Lig175 | Contacts |
| Exp_3P6Y | 3P6YG01 | Q16630_RRM1 | X-ray Diffraction | Lig175 | Contacts |
| Exp_3P6Y | 3P6YH01 | Q16630_RRM1 | X-ray Diffraction | Lig175 | Contacts |
| Exp_3P6Y | 3P6YK01 | Q16630_RRM1 | X-ray Diffraction | Lig175 | Contacts |
| Exp_3P6Y | 3P6YL01 | Q16630_RRM1 | X-ray Diffraction | Lig175 | Contacts |
| Exp_3P6Y | 3P6YO01 | Q16630_RRM1 | X-ray Diffraction | Lig175 | Contacts |
| Exp_3P6Y | 3P6YP01 | Q16630_RRM1 | X-ray Diffraction | Lig175 | Contacts |
RRM domains tested for Binding - 1
| RRM Entryname | Sequence Range | RRM Sequence |
|---|---|---|
| Q16630_RRM1 | 83 - 154 | LYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNP |