Lig179
Ligand information
- Ligand ID: Lig179
- Ligand Type : RNA
- Ligand Length : 55
- Ligand Sequence : GGAUCCAUUGCACUCCGGAUCCAGGAGAUACCAUGAUCACGAAGGUGGUUUUCCU
Available Structures for this Ligand- 1
| Ligand Structurename | PDB ID | Chain ID |
|---|---|---|
| 4PKDV00 | 4PKD | V |
Binding Information from Structures
| Experiment ID | RRM Structure | RRM Entryename | Experiment Type | Ligand ID | Contacts |
|---|---|---|---|---|---|
| Exp_4PKD | 4PKDB01 | Q06AA4_RRM1 | X-ray Diffraction | Lig179 | Contacts |
| Exp_4PKD | 4PKDB02 | P08621_RRM1 | X-ray Diffraction | Lig179 | Contacts |
RRM domains tested for Binding - 2
| RRM Entryname | Sequence Range | RRM Sequence |
|---|---|---|
| P08621_RRM1 | 105 - 175 | LFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVL |
| Q06AA4_RRM1 | 12 - 83 | IYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMR |