Lig47
Ligand information
- Ligand ID: Lig47
- Ligand Type : RNA
- Ligand Length : 75
- Ligand Sequence : GAUGGCCGGCAUGGUCCCAGCCUCCUCGCUGGCGCCGGCUGGGCAACACCAUUGCACUCCGGUGGUGAAUGGGAC
Available Structures for this Ligand- 2
Binding Information from Structures
| Experiment ID | RRM Structure | RRM Entryename | Experiment Type | Ligand ID | Contacts |
|---|---|---|---|---|---|
| Exp_2OIH | 2OIHA01 | P09012_RRM1 | X-ray Diffraction | Lig47 | Contacts |
| Exp_2OJ3 | 2OJ3A01 | P09012_RRM1 | X-ray Diffraction | Lig47 | Contacts |
RRM domains tested for Binding - 1
| RRM Entryname | Sequence Range | RRM Sequence |
|---|---|---|
| P09012_RRM1 | 12 - 83 | IYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMR |