Heterogeneous nuclear ribonucleoproteins A2/B1

Protein information

  • Protein ID: P22626
  • Protein Name : Heterogeneous nuclear ribonucleoproteins A2/B1
  • Gene : HNRNPA2B1
  • Organism : Homo sapiens
  • Status : reviewed
  • Function : Heterogeneous nuclear ribonucleoprotein (hnRNP) that associates with nascent pre-mRNAs packaging them into hnRNP particles. The hnRNP particle arrangement on nascent hnRNA is non-random and sequence-dependent and serves to condense and stabilize the transcripts and minimize tangling and knotting. Packaging plays a role in various processes such as transcription pre-mRNA processing RNA nuclear export subcellular location mRNA translation and stability of mature mRNAs (PubMed:19099192). Forms hnRNP particles with at least 20 other different hnRNP and heterogeneous nuclear RNA in the nucleus. Involved in transport of specific mRNAs to the cytoplasm in oligodendrocytes and neurons: acts by specifically recognizing and binding the A2RE (21 nucleotide hnRNP A2 response element) or the A2RE11 (derivative 11 nucleotide oligonucleotide) sequence motifs present on some mRNAs and promotes their transport to the cytoplasm (PubMed:10567417). Specifically binds single-stranded telomeric DNA sequences protecting telomeric DNA repeat against endonuclease digestion (By similarity). Also binds other RNA molecules such as primary miRNA (pri-miRNAs): acts as a nuclear 'reader' of the N6-methyladenosine (m6A) mark by specifically recognizing and binding a subset of nuclear m6A-containing pri-miRNAs. Binding to m6A-containing pri-miRNAs promotes pri-miRNA processing by enhancing binding of DGCR8 to pri-miRNA transcripts (PubMed:26321680). Involved in miRNA sorting into exosomes following sumoylation possibly by binding (m6A)-containing pre-miRNAs (PubMed:24356509). Acts as a regulator of efficiency of mRNA splicing possibly by binding to m6A-containing pre-mRNAs (PubMed:26321680). Plays a role in the splicing of pyruvate kinase PKM by binding repressively to sequences flanking PKM exon 9 inhibiting exon 9 inclusion and resulting in exon 10 inclusion and production of the PKM M2 isoform (PubMed:20010808). Also plays a role in the activation of the innate immune response (PubMed:31320558). Mechanistically senses the presence of viral DNA in the nucleus homodimerizes and is demethylated by JMJD6 (PubMed:31320558). In turn translocates to the cytoplasm where it activates the TBK1-IRF3 pathway leading to interferon alpha/beta production (PubMed:31320558).

Protein Sequence

  • MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY

RRM domains in this Protein - 2 

RRM Entryname RRM Sequence range Pfam ID
P22626_RRM1 23 - 92 PF00076
P22626_RRM2 114 - 183 PF00076

RRM domain Linkers in this Protein - 1 

Linker Name Linker Sequence range
P22626_linker1 93 - 113

Experiments retrieved for this Protein - 6 

Experiment ID Experiment Type PubMed ID
Exp_1X4B NMR
Exp_5EN1 X-ray Diffraction
Exp_5HO4 X-ray Diffraction 29379020
Exp_5WWE X-ray Diffraction 29379020
Exp_5WWF X-ray Diffraction 29379020
Exp_5WWG X-ray Diffraction 29379020

Ligands tested for Binding - 5 

Ligand ID Ligand Type Ligand Sequence
Lig133 RNA AGGACUG
Lig138 RNA AAGGACUAGC
Lig154 RNA AAGGACGAGC
Lig183 RNA AGGGACUAGC
Lig73 RNA AAGGACUUGC