U2 snRNP component IST3
Protein information
- Status : reviewed
- Function : Required for pre-mRNA splicing and spliceosome assembly. As part of the pre-mRNA retention and splicing (RES) complex required for nuclear pre-mRNA retention and efficient splicing. Required for MER1-activated splicing.
Protein Sequence
- MNKIQQINDKELQSGILSPHQSWHNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKRSLQKYYEAVKEELDRDIVSKNNAEKLILAKKDQPN
RRM domains in this Protein - 1
RRM Entryname | RRM Sequence range | Pfam ID |
---|---|---|
P40565_RRM1 | 33 - 103 | PF00076 |