Splicing factor U2AF 23 kDa subunit

Protein information

  • Protein ID: Q09176
  • Protein Name : Splicing factor U2AF 23 kDa subunit
  • Gene : SPAP8A3.06
  • Organism : Schizosaccharomyces pombe (strain 972 / ATCC 24843)
  • Status : reviewed
  • Function : Necessary for the splicing of pre-mRNA. The SF1-U2AF59-U2AF23 complex has a role in the recognition of the branch site (5'-UACUAAC-3') the pyrimidine tract and the 3'-splice site at the 3'-end of introns.

Protein Sequence

  • MASHLASIYGTEQDKVNCSFYYKIGACRHGERCSRKHVKPNFSQTILCPNMYKNPIHEPNGKKFTQRELAEQFDAFYEDMFCEFSKYGEVEQLVVCDNVGDHLVGNVYVRFKYEESAQNAIDDLNSRWYSQRPVYAELSPVTDFREACCRQHETSECQRGGLCNFMHAKKPSPQLLRDLVLAQRKYLALNAAEEMKKEPNSDSTNRWVSVTAERKN

RRM domains in this Protein - 1 

RRM Entryname RRM Sequence range Pfam ID
Q09176_RRM1 72 - 135 PF00076

Experiments retrieved for this Protein - 4 

Experiment ID Experiment Type PubMed ID
Exp_4YH8 X-ray Diffraction 26215567
Exp_7C06 X-ray Diffraction 32958768
Exp_7C07 X-ray Diffraction 32958768
Exp_7C08 X-ray Diffraction 32958768