Lig96
Ligand information
- Ligand ID: Lig96
- Ligand Type : RNA
- Ligand Length : 38
- Ligand Sequence : GUAUGUAUUUAUUUUNNNNNNNNNNUAGAUACUAACAC
Available Structures for this Ligand- 1
| Ligand Structurename | PDB ID | Chain ID |
|---|---|---|
| 5Y88E00 | 5Y88 | E |
Binding Information from Structures
| Experiment ID | RRM Structure | RRM Entryename | Experiment Type | Ligand ID | Contacts |
|---|---|---|---|---|---|
| Exp_5Y88 | 5Y88N01 | Q12046_RRM1 | EM | Lig96 | Contacts |
RRM domains tested for Binding - 1
| RRM Entryname | Sequence Range | RRM Sequence |
|---|---|---|
| Q12046_RRM1 | 149 - 206 | KHLKPAQIESRIRFVFSRLGDIDRIRYVESKNCGFVKFKYQANAEFAKEAMSNQTLLL |