Splicing factor 3B subunit 4

Protein information

  • Protein ID: Q15427
  • Protein Name : Splicing factor 3B subunit 4
  • Gene : SF3B4
  • Organism : Homo sapiens
  • Status : reviewed
  • Function : Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex (PubMed:27720643). SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential it may anchor U2 snRNP to the pre-mRNA (PubMed:12234937). May also be involved in the assembly of the 'E' complex. SF3B4 has been found in complex 'B' and 'C' as well (PubMed:10882114). Belongs also to the minor U12-dependent spliceosome which is involved in the splicing of rare class of nuclear pre-mRNA intron (PubMed:15146077).

Protein Sequence

  • MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPPGSFPPPVPPPGALPPGIPPAMPPPPMPPGAAGHGPPSAGTPGAGHPGHGHSHPHPFPPGGMPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPPRGPPFGSPMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGPLPPPRPTPRPPVPPRGPLRGPLPQ

RRM domains in this Protein - 2 

RRM Entryname RRM Sequence range Pfam ID
Q15427_RRM1 15 - 85 PF00076
Q15427_RRM2 102 - 173 PF00076

RRM domain Linkers in this Protein - 1 

Linker Name Linker Sequence range
Q15427_linker1 86 - 101

Experiments retrieved for this Protein - 15 

Experiment ID Experiment Type PubMed ID
Exp_1X5T NMR
Exp_5GVQ NMR 27862552
Exp_5Z56 EM 29360106
Exp_5Z57 EM 29360106
Exp_5Z58 EM 29360106
Exp_6AH0 EM 30315277
Exp_6AHD EM 30315277
Exp_6QX9 EM 30975767
Exp_6Y53 EM 32494006
Exp_6Y5Q EM 32494006
Exp_7ABG EM 33243851
Exp_7ABH EM 33243851
Exp_7ABI EM 33243851
Exp_7DVQ EM 33509932
Exp_7ONB EM 34301950