Splicing factor 3B subunit 6
-
Protein ID: Q9Y3B4
- Protein Name : Splicing factor 3B subunit 6
- Gene : SF3B6
- Organism : Homo sapiens
- Status : reviewed
- Function : Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex (PubMed:27720643). SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA (PubMed:12234937). Directly contacts the pre-mRNA branch site adenosine for the first catalytic step of splicing (PubMed:16432215). Enters the spliceosome and associates with the pre-mRNA branch site as part of the 17S U2 or in the case of the minor spliceosome as part of the 18S U11/U12 snRNP complex and thus may facilitate the interaction of these snRNP with the branch sites of U2 and U12 respectively (PubMed:16432215).
- MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
RRM Entryname |
RRM Sequence range |
Pfam ID |
Q9Y3B4_RRM1
|
21 - 88 |
PF00076 |